PPDB

The Plant Proteome Database

Search PPDB by:

HyperLink
HyperLink
HyperLink
HyperLink
HyperLink
HyperLink
HyperLink
HyperLink
HyperLink HyperLink HyperLink

 

PPDB home page

AT1G80600.1   HOPW1-1-interacting 1

Lab Annot. acetylornithine transaminase/AOTA/ACOAT)
Mapman: 13.1.2.3.4 amino acid metabolism.synthesis.glutamate family.arginine.acetylornithine aminotransferase
Curated Location plastid stroma (Pubmed: 23198870 18431481 ) (supported by in-house exprements)
Species Arabidopsis thaliana     Source: TAIR Arabidopsis (v.11)
Links TAIR   PeptideAtlas   POGS   SUBA   Uniprot   PTM     Get sequence
Related Genes

AccverSpeciesEvalueMatchlen%Iden%Similar#spotsTargetP
AT5G46180.1 11Arabidopsis thaliana3E-55406305027 (24)M
AT2G38400.1 11Arabidopsis thaliana3E-5241131482 (2)M
AT2G38400.2 11Arabidopsis thaliana7E-5039631480 (0)M
Os05g03830.1 7Oryza sativa0403688214 (14)C
Os07g27780.1 7Oryza sativa9E-13124172840 (0)M
Os03g44150.1 7Oryza sativa2E-5540931500 (0)M
v1_GRMZM2G119583_P01 4a53Zea mays0443597313 (13)C
GRMZM2G119583_P02 3.21Zea mays0403658021 (21)C
Zm00001eb264960_P003 agpv5Zea mays040365800 (0)C
Show all       

#Spots: The number of publicly accessible spots are in parenthesis

Prediction
PFAM: Aminotran_3(1)
TargetP: Chloroplast (Class 4 C0.716; M0.370; S0.019; _0.053)
Predotar:
Subcel. Location: Stroma
TM-HMM prediction: No
Aramemnon:
TAT position:
Length 457 aa (-cTP 414)
Molecular Weight 48.83 kDA(-cTP 44.03)
PI 6.37(-cTP 5.45)

Experimental Evidence

Expand

View Identified Peptides  

View GeneModel  

Expr*SpotMW nativeMW denaturedpI nativepI denaturedTypeMowseAmbiguityTissueSample fromGenotype
94Detail       root [B. rapa] plastid stroma 
102Detail       petal [B. oleracea] plastid stromaAlboglabra
119Detail       root [B. rapa] plastid stroma 
135Detail       leaf [A. thaliana] plastid thylakoid membranewild-type
151Detail       leaf [A. thaliana] chloroplast stromawild-type
303Detail       leaf [A. thaliana] chloroplast stromawild-type
326Detail       leaf [A. thaliana] chloroplast stromawild-type
339Detail       leaf [A. thaliana] chloroplast stromawild-type
351Detail       leaf [A. thaliana] total leaf tissue 1.07 wild-type
352Detail       leaf [A. thaliana] total leaf tissue 1.07 wild-type
355Detail       leaf [A. thaliana] total leaf tissue 1.07 wild-type
356Detail       leaf [A. thaliana] total leaf tissue 1.07 wild-type
361Detail       leaf [A. thaliana] total leaf tissue 1.07 wild-type
371Detail       leaf [A. thaliana] total leaf tissue clpr4-1
451Detail       leaf [A. thaliana] total leaf tissue clpr4-1
527Detail       leaf [A. thaliana] total leaf tissue wild-type (wt1)
528Detail       leaf [A. thaliana] total leaf tissue wild-type (wt2)
544Detail       leaf [A. thaliana] stroma (FPLC) <600 kDa (LMA) wild-type
618Detail       leaf [A. thaliana] chloroplast stromaclpr2-1
621Detail       leaf [A. thaliana] total leaf tissue clpr4-1
622Detail       leaf [A. thaliana] total leaf tissue wild-type
869Detail       leaf [A. thaliana] chloroplast stromawild-type
870Detail       leaf [A. thaliana] chloroplast stromawild-type
871Detail       leaf [A. thaliana] chloroplast stromawild-type
873Detail       leaf [A. thaliana] chloroplast stromawild-type
874Detail       leaf [A. thaliana] chloroplast stromawild-type
876Detail       leaf [A. thaliana] chloroplast thylakoid membranewild-type
1127Detail       leaf [A. thaliana] chloroplast plastoglobulek2k3
1345Detail       leaf [A. thaliana] total tissue (5 day HL) wild-type (rep. 1)
1346Detail       leaf [A. thaliana] total tissue (5 day HL) wild-type (rep. 2)
1347Detail       leaf [A. thaliana] total tissue (5 day HL) wild-type (rep. 3)
1348Detail       leaf [A. thaliana] total tissue (5 day HL) abck2xabck3 (rep. 1)
1349Detail       leaf [A. thaliana] total tissue (5 day HL) abck2xabck3 (rep. 2)
1350Detail       leaf [A. thaliana] total tissue (5 day HL) abck2xabck3 (rep. 3)
1392Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 1)
1393Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 2)
1394Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 1)
1395Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 1)
1396Detail       leaf [A. thaliana] total leaf tissue clpt1xclpt2 (rep. 2)
1397Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 3)
1399Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 clpp3-1
1400Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 wild-type
1401Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 clpp3-1
1402Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 wild-type
1403Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 clpp3-1
1404Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 wild-type
1405Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 2. wild-type
1406Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 2. wild-type
1407Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 2. clpr2-1
1408Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 2. clpr2-1
1409Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 1.1 wild-type
1410Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 1.2 wild-type
1411Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 1.1 clpr2-1
1412Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 1.2 clpr2-1
1413Detail       leaf [A. thaliana] total leaf tissue -114 rep1tR1 wild-type
1414Detail       leaf [A. thaliana] total leaf tissue -114 rep1tR2 wild-type
1415Detail       leaf [A. thaliana] total leaf tissue 1.14 rep 1.1 clpr2-1
1416Detail       leaf [A. thaliana] total leaf tissue 1.14 rep 1.2 clpr2-1
1417Detail       leaf [A. thaliana] total tissue (2% sucrose) clpr4-1 (rep. 2)
1418Detail       leaf [A. thaliana] total tissue (2% sucrose) clpr4-1 (rep. 3)
1421Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 1)
1422Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 2)
1423Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 3)
1424Detail       leaf [A. thaliana] total leaf tissue prep1xprep2xt1xt2 (rep. 1)
1425Detail       leaf [A. thaliana] total leaf tissue prep1xprep2xt1xt2 (rep. 2)
1426Detail       leaf [A. thaliana] total leaf tissue prep1xprep2xt1xt2 (rep. 3)
1431Detail       leaf [A. thaliana] total tissue (2% sucrose) wild-type (rep. 2)
1432Detail       leaf [A. thaliana] total tissue (2% sucrose) wild-type (rep. 2)
1439Detail       leaf [A. thaliana] total tissue (0 day HL) wild-type (rep. 1)
1440Detail       leaf [A. thaliana] total tissue (0 day HL) wild-type (rep. 2)
1441Detail       leaf [A. thaliana] total tissue (0 day HL) wild-type (rep. 3)
1442Detail       leaf [A. thaliana] total tissue (0 day HL) abck2xabck3 (rep. 1)
1443Detail       leaf [A. thaliana] total tissue (0 day HL) abck2xabck3 (rep. 2)
1444Detail       leaf [A. thaliana] total tissue (0 day HL) abck2xabck3 (rep. 3)
1445Detail       leaf [A. thaliana] total tissue (3 day HL) wild-type (rep. 1)
1446Detail       leaf [A. thaliana] total tissue (3 day HL) wild-type (rep. 2)
1447Detail       leaf [A. thaliana] total tissue (3 day HL) wild-type (rep. 3)
1448Detail       leaf [A. thaliana] total tissue (3 day HL) abck2xabck3 (rep. 1)
1449Detail       leaf [A. thaliana] total tissue (3 day HL) abck2xabck3 (rep. 2)
1450Detail       leaf [A. thaliana] total tissue (0 day HL) abck2xabck3 (rep. 3)
1455Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 1)
1456Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 2)
1457Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 3)
1458Detail       leaf [A. thaliana] chloroplast stromaclps (rep. 1)
1459Detail       leaf [A. thaliana] chloroplast stromaclps (rep. 2)
1460Detail       leaf [A. thaliana] chloroplast stromaclps (rep. 3)
1461Detail       leaf [A. thaliana] chloroplast stromaclpc1 (rep. 1)
1462Detail       leaf [A. thaliana] chloroplast stromaclpc1 (rep. 2)
1463Detail       leaf [A. thaliana] chloroplast stromaclpc1 (rep. 3)
1481Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 1)
1482Detail       leaf [A. thaliana] chloroplast stromaclpc1 x clps (rep. 1)
1483Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 2)
1484Detail       leaf [A. thaliana] chloroplast stromaclpc1 x clps (rep. 2)
1485Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 3)
1486Detail       leaf [A. thaliana] chloroplast stromaclpc1 x clps (rep. 3)
1519Detail       leaf [A. thaliana] wild-type
1529Detail       leaf [A. thaliana] total leaf tissue - 0 uM CAP wild-type (rep. 1)
1530Detail       leaf [A. thaliana] total leaf tissue - 30 uM CAP wild-type (rep. 1)
1531Detail       leaf [A. thaliana] total leaf tissue - 40 uM CAP wild-type (rep. 1)
1532Detail       leaf [A. thaliana] total leaf tissue - 0 uM CAP clps (rep. 1)
1533Detail       leaf [A. thaliana] total leaf tissue - 30 uM CAP clps (rep. 1)
1534Detail       leaf [A. thaliana] total leaf tissue - 40 uM CAP clps (rep. 1)
1596Detail        [A. thaliana]  
1870Detail       Total leaf [A. thaliana] Stroma wild-type
1871Detail       Total leaf [A. thaliana] Stroma wild-type
1872Detail       Total leaf [A. thaliana] Stroma wild-type
1933Detail       leaf [A. thaliana] chloroplast wild-type
1934Detail       leaf [A. thaliana] chloroplast wild-type
1935Detail       leaf [A. thaliana] chloroplast wild-type
1937Detail       leaf [A. thaliana] chloroplast Prep1_Prep2
1938Detail       leaf [A. thaliana] chloroplast Prep1_Prep2
1941Detail       leaf [A. thaliana] stroma WT stromawild-type
1942Detail       leaf [A. thaliana] stroma WT stromawild-type
1943Detail       leaf [A. thaliana] stroma WT stromawild-type
1944Detail       leaf [A. thaliana] stroma UVR stromaUVR
1945Detail       leaf [A. thaliana] stroma UVR stromaUVR
1946Detail       leaf [A. thaliana] stroma UVR stromawild-type
1947Detail       leaf [A. thaliana] stroma ClpS stromaclpS
1948Detail       leaf [A. thaliana] stroma ClpS stromaclpS
1949Detail       leaf [A. thaliana] stroma ClpS stromaclpS
1983Detail       leaf [A. thaliana] plastid wild-type
1984Detail       leaf [A. thaliana] plastid wild-type
1985Detail       leaf [A. thaliana] plastid wild-type
1986Detail       leaf [A. thaliana] plastid Prep1_Prep2
1987Detail       leaf [A. thaliana] plastid Prep1_Prep2
1988Detail       leaf [A. thaliana] plastid Prep1_Prep2
2006Detail       leaf [A. thaliana] over expressed M48 plastoglobuleM48
2007Detail       leaf [A. thaliana] WT PG plastoglobuleWT
2009Detail       leaf [A. thaliana] total leaf tissue wild-type
2010Detail       leaf [A. thaliana] total leaf tissue prep1-1xprep2-1
2011Detail       leaf [A. thaliana] total leaf tissue opda1-2
2013Detail       leaf [A. thaliana] total leaf tissue wt
2014Detail       leaf [A. thaliana] total leaf tissue prep1-1xprep2-1
2015Detail       leaf [A. thaliana] total leaf tissue opda1-2
2016Detail       leaf [A. thaliana] total leaf tissue prep1-1xprep2-1xopda1-2
2017Detail       leaf [A. thaliana] total leaf tissue wild-type
2019Detail       leaf [A. thaliana] total leaf tissue opda1-2
2020Detail       leaf [A. thaliana] total leaf tissue prep1-1xprep2-1xopda1-2
2056Detail       Total leaf [A. thaliana] chloroplast stromawt and cgep
2076Detail       Total leaf [A. thaliana] total soluble wt & clpt1xclpt2
2077Detail       Total leaf [A. thaliana] total soluble wt & clpt1xclpt2
2080Detail       Total leaf [A. thaliana] total soluble wt & clpt1xclpt2
2082Detail       Total leaf [A. thaliana] total soluble wt & clpt1xclpt2
2083Detail       Total leaf [A. thaliana] total soluble wt & clpt1xclpt2
2086Detail       Total leaf [A. thaliana] total soluble wt & clpt1xclpt2
2113Detail       leaf [A. thaliana] Stroma stromawt
2114Detail       leaf [A. thaliana] Stroma stromawt
2115Detail       leaf [A. thaliana] Stroma stromacGep
2116Detail       leaf [A. thaliana] Stroma stromacGep
2117Detail       leaf [A. thaliana] Stroma stromacGep
2141Detail       Total leaf [A. thaliana] total soluble stromawt & cgep
2142Detail       Total leaf [A. thaliana] total soluble stromawt & cgep
2144Detail       Total leaf [A. thaliana] total soluble stromawt & cgep
2145Detail       Total leaf [A. thaliana] total soluble stromawt & cgep
2147Detail       Total leaf [A. thaliana] total soluble stromawt & cgep
2148Detail       Total leaf [A. thaliana] total soluble stromawt & cgep
2149Detail       Total leaf [A. thaliana] total soluble stromawt & cgep
2150Detail       Total leaf [A. thaliana] total soluble stromawt & cgep
2151Detail       Total leaf [A. thaliana] total soluble stromawt & cgep
2152Detail       Total leaf [A. thaliana] total soluble stromawt & cgep
2182Detail       Rosettes [A. thaliana] total soluble tic40 and wt
2183Detail       Rosettes [A. thaliana] total soluble tic40 and wt
2184Detail       Rosettes [A. thaliana] total soluble tic40 and wt
2185Detail       Rosettes [A. thaliana] total soluble tic40 and wt
2193Detail        [A. thaliana] total soluble P3-strepII 26
2209Detail       leaf [A. thaliana] total leaf tissue Clp P5 Trapst 10
2216Detail       leaf [A. thaliana] total leaf tissue Clp P5 st
2224Detail       leaf [A. thaliana] total leaf tissue Clp P3 strep
2225Detail       leaf [A. thaliana] total leaf tissue Clp P3 trap
2226Detail       leaf [A. thaliana] total leaf tissue wild-type
2287Detail        [A. thaliana] Clp C1 WT
2297Detail        [A. thaliana] Clp C1 WT
2308Detail       leaf [A. thaliana] PG plastoglobule 
2310Detail       leaf [A. thaliana] PG plastoglobule 
2311Detail       leaf [A. thaliana] PG plastoglobule 
2312Detail       leaf [A. thaliana] thylakoids thylakoid membrane 
2313Detail       leaf [A. thaliana] thylakoids thylakoid membrane 
2314Detail       leaf [A. thaliana] thylakoids thylakoid membrane 
2316Detail       leaf [A. thaliana] PG plastoglobule 
2317Detail       leaf [A. thaliana] PG plastoglobule 
2318Detail       leaf [A. thaliana] PG plastoglobule 
2319Detail       leaf [A. thaliana] PG plastoglobule 
2320Detail        [A. thaliana] Thylakoids plastoglobule 
2321Detail       leaf [A. thaliana]  
2324Detail       leaf [A. thaliana] THYLAKOIDS thylakoid membrane 
2325Detail       leaf [A. thaliana] thylakoids thylakoid membraneabc1k6
2398Detail       leaf-soluble [A. thaliana] GFP-nano-trap wt/35SRecA-GFP
2400Detail       leaf-soluble [A. thaliana] GFP-nano-trap wt/DUF760-1GFP/ClpC1TRAPSTREP

* For details about the exprimental sources click here.

Published Proteomics Data

15028209(Total chloroplast)
16207701(chloroplast stroma)
18538804(total leaf)
18431481(chloroplast)
19546170(mature pollen grains)
19525416(leaf (wt and clpr4-1 mutant))
17216043(leaf)
20423899(chloroplast)
19888209(80S polysomal fraction)
19888209(leaves)
20018591(weak Cu-2+ binding (mitochondria - cell culture))
19423572(leaf (wt and clpr2-1))
19423572(stroma chloroplast (wt and clpr2-1))
19995723(chloroplast reference proteome)
21533090(plasmodesmata-crude)
21173025(root proteome)
21472856(mitochondrial-2DEgels-uncurated)

Comparative Proteomics Data

Expr*SourceTech.SpotPepSeqChargeState(z)AreaRatioAmbiguityTissueSample from
180_181clpr2-1 cICAT - exp1 / wt cICAT - exp1cICAT5SACDAAGSLLVFDEVQCGLGR + 2 ICAT_l / SACDAAGSLLVFDEVQCGLGR + 2 ICAT_h30.95 leaf [A. thaliana] chloroplast stroma
180_181clpr2-1 cICAT - exp1 / wt cICAT - exp1cICAT5VAETINYGDHGSTFAGSPLVCSAAIAVMDK + ICAT_l / VAETINYGDHGSTFAGSPLVCSAAIAVMDK + ICAT_h30.94 leaf [A. thaliana] chloroplast stroma

©Klaas J. van Wijk Lab, Cornell University   Web Accessibility Help