PPDB

 The Plant Proteome Database

Search PPDB by:

HyperLink
HyperLink
HyperLink
HyperLink
HyperLink
HyperLink
HyperLink
HyperLink
HyperLink HyperLink HyperLink

 

PPDB home page

AT1G10760.1   Pyruvate phosphate dikinase%2C PEP/pyruvate binding domain-containing protein
Lab Annot. glycan water dikinase 1 (GWD1; Sex1;R1 protein)
Mapman: 2.2.2.3 major CHO metabolism.degradation.starch.glucan water dikinase
Curated Location plastid stroma (Pubmed: 23198870 11487701 18431481 ) (supported by in-house exprements)

TAIR curated location: mitochondrion14671022
Species Arabidopsis thaliana     Source: TAIR Arabidopsis (v.11)
Links TAIR   PeptideAtlas   POGS   SUBA   Uniprot   PTM     Get sequence
Related Genes

AccverSpeciesEvalueMatchlen%Iden%Similar#spotsTargetP
AT1G10760.3 11Arabidopsis thaliana013991001000 (0)C
AT1G10760.2 11Arabidopsis thaliana013991001000 (0)C
AT4G24450.1 11Arabidopsis thaliana0132647643 (3)_
Os06g30310.1 7Oryza sativa01413587055 (55)M
Os12g20150.1 7Oryza sativa4E-42613254327 (27)C
Os01g51754.4 7Oryza sativa9E-0610729500 (0)C
Zm00001eb278140_P001 agpv5Zea mays0141163760 (0)C
GRMZM2G412611_P01 3.21Zea mays014116376133 (68)C
v1_GRMZM2G412611_P01 4a53Zea mays0661486257 (56)C
Show all       

#Spots: The number of publicly accessible spots are in parenthesis
Prediction
PFAM: CBM53(2) PPDK_N(2)
TargetP: Chloroplast (Class 5 C0.307; M0.215; S0.019; _0.268)
Predotar:
Subcel. Location: Stroma
TM-HMM prediction: No
Aramemnon:
TAT position:
Length 1399 aa (-cTP 1322)
Molecular Weight 156.58 kDA(-cTP 148.24)
PI 5.66(-cTP 5.35)

Experimental Evidence

Expand

View Identified Peptides  

View GeneModel  
Expr*SpotMW nativeMW denaturedpI nativepI denaturedTypeMowseAmbiguityTissueSample fromGenotype
94Detail       root [B. rapa] plastid stroma 
119Detail       root [B. rapa] plastid stroma 
151Detail       leaf [A. thaliana] chloroplast stromawild-type
180_181Detail       leaf [A. thaliana] chloroplast stromaclpr2-1
195_194Detail       leaf [A. thaliana] chloroplast stromaffc1-2
249_250Detail       leaf [A. thaliana] chloroplast stromaffc1-2
272Detail       leaf [A. thaliana] chloroplast stromaclpr2-1
303Detail       leaf [A. thaliana] chloroplast stromawild-type
326Detail       leaf [A. thaliana] chloroplast stromawild-type
327Detail       leaf [A. thaliana] chloroplast thylakoid membranewild-type
339Detail       leaf [A. thaliana] chloroplast stromawild-type
342Detail       leaf [A. thaliana] chloroplast low density membranewild-type
343Detail       leaf [A. thaliana] chloroplast thylakoid membranewild-type
351Detail       leaf [A. thaliana] total leaf tissue 1.07 wild-type
352Detail       leaf [A. thaliana] total leaf tissue 1.07 wild-type
361Detail       leaf [A. thaliana] total leaf tissue 1.07 wild-type
371Detail       leaf [A. thaliana] total leaf tissue clpr4-1
412Detail       leaf [A. thaliana] stroma - R-X102 tag-CNPAGE clpr2-1-TapTagR2
451Detail       leaf [A. thaliana] total leaf tissue clpr4-1
484Detail       leaf [A. thaliana] chloroplast plastoglobulewild-type
527Detail       leaf [A. thaliana] total leaf tissue wild-type (wt1)
528Detail       leaf [A. thaliana] total leaf tissue wild-type (wt2)
544Detail       leaf [A. thaliana] stroma (FPLC) <600 kDa (LMA) wild-type
617Detail       leaf [A. thaliana] chloroplast stromawild-type
618Detail       leaf [A. thaliana] chloroplast stromaclpr2-1
619Detail       leaf [A. thaliana] chloroplast stromawild-type
620Detail       leaf [A. thaliana] chloroplast stromaclpr2-1
621Detail       leaf [A. thaliana] total leaf tissue clpr4-1
622Detail       leaf [A. thaliana] total leaf tissue wild-type
698Detail       leaf [A. thaliana] stroma- QconCAT wild-type
869Detail       leaf [A. thaliana] chloroplast stromawild-type
870Detail       leaf [A. thaliana] chloroplast stromawild-type
871Detail       leaf [A. thaliana] chloroplast stromawild-type
873Detail       leaf [A. thaliana] chloroplast stromawild-type
874Detail       leaf [A. thaliana] chloroplast stromawild-type
875Detail       leaf [A. thaliana] chloroplast stromawild-type
876Detail       leaf [A. thaliana] chloroplast thylakoid membranewild-type
877Detail       leaf [A. thaliana] chloroplast stromawild-type
1126Detail       leaf [A. thaliana] chloroplast plastoglobulek2k3
1127Detail       leaf [A. thaliana] chloroplast plastoglobulek2k3
1176Detail       leaf [A. thaliana] co-IP ClpR2 stromawild-type
1179Detail       leaf [A. thaliana] co-IP ClpR2 stromaclpr2-1
1202Detail       leaf [A. thaliana] total leaf tissue clpp3 null
1207Detail       leaf [A. thaliana] total leaf tissue clpp3 null
1208Detail       leaf [A. thaliana] total leaf tissue clpp3 null
1215Detail       leaf [A. thaliana] co-IP ClpR2 stromawild-type
1294Detail       leaf [A. thaliana] co-IP cGEP (rep. 2) stromawild-type
1345Detail       leaf [A. thaliana] total tissue (5 day HL) wild-type (rep. 1)
1346Detail       leaf [A. thaliana] total tissue (5 day HL) wild-type (rep. 2)
1347Detail       leaf [A. thaliana] total tissue (5 day HL) wild-type (rep. 3)
1348Detail       leaf [A. thaliana] total tissue (5 day HL) abck2xabck3 (rep. 1)
1349Detail       leaf [A. thaliana] total tissue (5 day HL) abck2xabck3 (rep. 2)
1350Detail       leaf [A. thaliana] total tissue (5 day HL) abck2xabck3 (rep. 3)
1392Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 1)
1393Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 2)
1394Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 1)
1395Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 1)
1396Detail       leaf [A. thaliana] total leaf tissue clpt1xclpt2 (rep. 2)
1397Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 3)
1399Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 clpp3-1
1400Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 wild-type
1401Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 clpp3-1
1402Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 wild-type
1403Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 clpp3-1
1404Detail       leaf [A. thaliana] total leaf tissue 1.14 -rep. 1 wild-type
1405Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 2. wild-type
1406Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 2. wild-type
1407Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 2. clpr2-1
1408Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 2. clpr2-1
1409Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 1.1 wild-type
1410Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 1.2 wild-type
1411Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 1.1 clpr2-1
1412Detail       leaf [A. thaliana] total leaf tissue 1.07 rep 1.2 clpr2-1
1415Detail       leaf [A. thaliana] total leaf tissue 1.14 rep 1.1 clpr2-1
1416Detail       leaf [A. thaliana] total leaf tissue 1.14 rep 1.2 clpr2-1
1417Detail       leaf [A. thaliana] total tissue (2% sucrose) clpr4-1 (rep. 2)
1418Detail       leaf [A. thaliana] total tissue (2% sucrose) clpr4-1 (rep. 3)
1421Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 1)
1422Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 2)
1423Detail       leaf [A. thaliana] total leaf tissue wild-type (rep. 3)
1424Detail       leaf [A. thaliana] total leaf tissue prep1xprep2xt1xt2 (rep. 1)
1425Detail       leaf [A. thaliana] total leaf tissue prep1xprep2xt1xt2 (rep. 2)
1426Detail       leaf [A. thaliana] total leaf tissue prep1xprep2xt1xt2 (rep. 3)
1431Detail       leaf [A. thaliana] total tissue (2% sucrose) wild-type (rep. 2)
1432Detail       leaf [A. thaliana] total tissue (2% sucrose) wild-type (rep. 2)
1439Detail       leaf [A. thaliana] total tissue (0 day HL) wild-type (rep. 1)
1440Detail       leaf [A. thaliana] total tissue (0 day HL) wild-type (rep. 2)
1441Detail       leaf [A. thaliana] total tissue (0 day HL) wild-type (rep. 3)
1442Detail       leaf [A. thaliana] total tissue (0 day HL) abck2xabck3 (rep. 1)
1443Detail       leaf [A. thaliana] total tissue (0 day HL) abck2xabck3 (rep. 2)
1444Detail       leaf [A. thaliana] total tissue (0 day HL) abck2xabck3 (rep. 3)
1445Detail       leaf [A. thaliana] total tissue (3 day HL) wild-type (rep. 1)
1446Detail       leaf [A. thaliana] total tissue (3 day HL) wild-type (rep. 2)
1447Detail       leaf [A. thaliana] total tissue (3 day HL) wild-type (rep. 3)
1448Detail       leaf [A. thaliana] total tissue (3 day HL) abck2xabck3 (rep. 1)
1449Detail       leaf [A. thaliana] total tissue (3 day HL) abck2xabck3 (rep. 2)
1450Detail       leaf [A. thaliana] total tissue (0 day HL) abck2xabck3 (rep. 3)
1453Detail       leaf [A. thaliana] chloroplast nucleoidwild-type (rep. 1)
1454Detail       leaf [A. thaliana] chloroplast nucleoidwild-type (rep. 2)
1455Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 1)
1456Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 2)
1457Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 3)
1458Detail       leaf [A. thaliana] chloroplast stromaclps (rep. 1)
1459Detail       leaf [A. thaliana] chloroplast stromaclps (rep. 2)
1460Detail       leaf [A. thaliana] chloroplast stromaclps (rep. 3)
1461Detail       leaf [A. thaliana] chloroplast stromaclpc1 (rep. 1)
1462Detail       leaf [A. thaliana] chloroplast stromaclpc1 (rep. 2)
1463Detail       leaf [A. thaliana] chloroplast stromaclpc1 (rep. 3)
1465Detail       leaf [A. thaliana] co-IP GST-ClpS stroma clpc1 x clps (rep. 1)
1467Detail       leaf [A. thaliana] co-IP GST-ClpS stroma clpc1 x clps (rep. 2)
1469Detail       leaf [A. thaliana] co-IP GST-ClpS stroma clpc1 x clps (rep. 3)
1479Detail       leaf [A. thaliana] co-IP GST-ClpS stroma clpc1 x clps (rep. 6)
1481Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 1)
1482Detail       leaf [A. thaliana] chloroplast stromaclpc1 x clps (rep. 1)
1483Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 2)
1484Detail       leaf [A. thaliana] chloroplast stromaclpc1 x clps (rep. 2)
1485Detail       leaf [A. thaliana] chloroplast stromawild-type (rep. 3)
1486Detail       leaf [A. thaliana] chloroplast stromaclpc1 x clps (rep. 3)
1517Detail       leaf [A. thaliana] wild-type
1518Detail       leaf [A. thaliana] wild-type
1520Detail       leaf [A. thaliana] wild-type
1522Detail       leaf [A. thaliana] wild-type
1523Detail       leaf [A. thaliana] wild-type
1528Detail       leaf [A. thaliana] chloroplast nucleoidwild-type (rep. 1)
1529Detail       leaf [A. thaliana] total leaf tissue - 0 uM CAP wild-type (rep. 1)
1530Detail       leaf [A. thaliana] total leaf tissue - 30 uM CAP wild-type (rep. 1)
1531Detail       leaf [A. thaliana] total leaf tissue - 40 uM CAP wild-type (rep. 1)
1532Detail       leaf [A. thaliana] total leaf tissue - 0 uM CAP clps (rep. 1)
1533Detail       leaf [A. thaliana] total leaf tissue - 30 uM CAP clps (rep. 1)
1534Detail       leaf [A. thaliana] total leaf tissue - 40 uM CAP clps (rep. 1)
1535Detail       leaf [A. thaliana] wild-type
1536Detail       leaf [A. thaliana] wild-type
1541Detail       leaf [A. thaliana] Thylakoids plastoglobuleM-48
1542Detail       leaf [A. thaliana] wild-type
1545Detail       leaf [A. thaliana] TiO2 thylakoid membranewt
1557Detail       leaf [A. thaliana] TiO2 thylakoid membranewt
1566Detail       leaf [A. thaliana] TiO2 thylakoid membranek2k3
1567Detail       leaf [A. thaliana] TiO2 thylakoid membranek2k3
1596Detail        [A. thaliana]  
1597Detail        [A. thaliana]  
1611Detail       leaf [A. thaliana] chloroplast fractionation thylakoid membrane 
1612Detail       Natural Senescence leaf [A. thaliana] chloroplast fractionation thylakoid membrane 
1613Detail       Natural Senescence leaf [A. thaliana]  
1614Detail       Natural Senescence leaf [A. thaliana]  
1615Detail       Natural Senescence leaf [A. thaliana]  
1616Detail       Natural Senescence leaf [A. thaliana]  
1617Detail        [A. thaliana] m48
1618Detail        [A. thaliana] m48
1619Detail        [A. thaliana] m48
1620Detail        [A. thaliana] m48
1621Detail        [A. thaliana] m48
1622Detail        [A. thaliana] m48
1650Detail       leaf [A. thaliana] plastoglobules plastoglobulem48
1651Detail       leaf [A. thaliana] plastoglobules plastoglobulewild-type
1765Detail       leaf [A. thaliana] Thylakoids thylakoid membraneCol-0
1766Detail       leaf [A. thaliana] Thylakoids thylakoid membraneMet1-1
1828Detail       leaf [A. thaliana] Thylakoids thylakoid membraneCol-0 Fluctuating light
1829Detail       leaf [A. thaliana] Thylakoids thylakoid membraneMet1-1 Fluctuating light
1830Detail       leaf [A. thaliana] Thylakoids thylakoid membraneCol-0 Normal light
1831Detail       leaf [A. thaliana] Thylakoids thylakoid membraneMet1-1 Normal light
1832Detail       leaf [A. thaliana] Thylakoids thylakoid membraneCol-0 Normal light
1833Detail       leaf [A. thaliana] Thylakoids thylakoid membraneMet1-1
1872Detail       Total leaf [A. thaliana] Stroma wild-type
1875Detail       Total leaf [A. thaliana] total soluble wild-type
1933Detail       leaf [A. thaliana] chloroplast wild-type
1934Detail       leaf [A. thaliana] chloroplast wild-type
1935Detail       leaf [A. thaliana] chloroplast wild-type
1936Detail       leaf [A. thaliana] chloroplast Prep1_Prep2
1937Detail       leaf [A. thaliana] chloroplast Prep1_Prep2
1938Detail       leaf [A. thaliana] chloroplast Prep1_Prep2
1941Detail       leaf [A. thaliana] stroma WT stromawild-type
1942Detail       leaf [A. thaliana] stroma WT stromawild-type
1943Detail       leaf [A. thaliana] stroma WT stromawild-type
1944Detail       leaf [A. thaliana] stroma UVR stromaUVR
1945Detail       leaf [A. thaliana] stroma UVR stromaUVR
1946Detail       leaf [A. thaliana] stroma UVR stromawild-type
1947Detail       leaf [A. thaliana] stroma ClpS stromaclpS
1948Detail       leaf [A. thaliana] stroma ClpS stromaclpS
1949Detail       leaf [A. thaliana] stroma ClpS stromaclpS
1983Detail       leaf [A. thaliana] plastid wild-type
1984Detail       leaf [A. thaliana] plastid wild-type
1985Detail       leaf [A. thaliana] plastid wild-type
1986Detail       leaf [A. thaliana] plastid Prep1_Prep2
1987Detail       leaf [A. thaliana] plastid Prep1_Prep2
1988Detail       leaf [A. thaliana] plastid Prep1_Prep2
1999Detail       leaf [A. thaliana] stroma ClpS stromaclpS1
2000Detail       leaf [A. thaliana] stroma ClpS stromaclpS1
2001Detail       leaf [A. thaliana] stroma ClpS stromaclpS1
2002Detail       leaf [A. thaliana] stroma ClpS stromaclpS1
2003Detail       leaf [A. thaliana] over expressed M48 plastoglobuleM48
2006Detail       leaf [A. thaliana] over expressed M48 plastoglobuleM48
2008Detail       leaf [A. thaliana] RNAi PG plastoglobuleRNAi
2009Detail       leaf [A. thaliana] total leaf tissue wild-type
2010Detail       leaf [A. thaliana] total leaf tissue prep1-1xprep2-1
2011Detail       leaf [A. thaliana] total leaf tissue opda1-2
2012Detail       leaf [A. thaliana] total leaf tissue prep1-1xprep2-1xopda1-2
2013Detail       leaf [A. thaliana] total leaf tissue wt
2014Detail       leaf [A. thaliana] total leaf tissue prep1-1xprep2-1
2015Detail       leaf [A. thaliana] total leaf tissue opda1-2
2016Detail       leaf [A. thaliana] total leaf tissue prep1-1xprep2-1xopda1-2
2017Detail       leaf [A. thaliana] total leaf tissue wild-type
2018Detail       leaf [A. thaliana] total leaf tissue prep1-1xprep2-1
2019Detail       leaf [A. thaliana] total leaf tissue opda1-2
2020Detail       leaf [A. thaliana] total leaf tissue prep1-1xprep2-1xopda1-2
2028Detail       leaf [A. thaliana] WT PG plastoglobuleWT
2029Detail       leaf [A. thaliana] over expressed M48 plastoglobuleM48
2030Detail       leaf [A. thaliana] over expressed M48 plastoglobuleM48
2076Detail       Total leaf [A. thaliana] total soluble wt & clpt1xclpt2
2112Detail       leaf [A. thaliana] Stroma stromawt
2113Detail       leaf [A. thaliana] Stroma stromawt
2114Detail       leaf [A. thaliana] Stroma stromawt
2115Detail       leaf [A. thaliana] Stroma stromacGep
2116Detail       leaf [A. thaliana] Stroma stromacGep
2117Detail       leaf [A. thaliana] Stroma stromacGep
2182Detail       Rosettes [A. thaliana] total soluble tic40 and wt
2183Detail       Rosettes [A. thaliana] total soluble tic40 and wt
2184Detail       Rosettes [A. thaliana] total soluble tic40 and wt
2185Detail       Rosettes [A. thaliana] total soluble tic40 and wt
2191Detail        [A. thaliana] plastid stroma stromaP3-trap-strepII 40
2193Detail        [A. thaliana] total soluble P3-strepII 26
2208Detail       leaf [A. thaliana] total leaf tissue Clp P5 strepII
2211Detail       leaf [A. thaliana] total leaf tissue Clp P5 Trapst 12
2216Detail       leaf [A. thaliana] total leaf tissue Clp P5 st
2218Detail       Total soluble [A. thaliana] Total soluble proteins cGEP strep
2224Detail       leaf [A. thaliana] total leaf tissue Clp P3 strep
2225Detail       leaf [A. thaliana] total leaf tissue Clp P3 trap
2226Detail       leaf [A. thaliana] total leaf tissue wild-type
2247Detail       seedlings [A. thaliana] total tissue atg5
2249Detail       seedlings [A. thaliana] total tissue gfs9
2250Detail       seedlings [A. thaliana] total tissue atg5
2251Detail       seedlings [A. thaliana] total tissue wild-type
2252Detail       seedlings [A. thaliana] total tissue gfs9
2253Detail       seedlings [A. thaliana] total tissue atg5
2266Detail       leaf [A. thaliana] stroma Clp Clp C1 wild-type
2271Detail       seedlings [A. thaliana] total tissue wild-type
2286Detail        [A. thaliana] Clp C1 WT
2287Detail        [A. thaliana] Clp C1 WT
2289Detail        [A. thaliana] Clp C1 TRAP
2290Detail        [A. thaliana] Clp C1 TRAP
2291Detail        [A. thaliana] Clp C1 TRAP
2296Detail        [A. thaliana] Clp C1 WT
2297Detail        [A. thaliana] Clp C1 WT
2298Detail        [A. thaliana] Clp C1 WT
2299Detail        [A. thaliana] Clp C1 TRAP
2300Detail        [A. thaliana] Clp C1 TRAP
2301Detail        [A. thaliana] Clp C1 TRAP
2302Detail        [A. thaliana] Clp C1 WT
2303Detail        [A. thaliana] Clp C1 WT
2305Detail        [A. thaliana] Clp C1 TRAP
2306Detail        [A. thaliana] Clp C1 TRAP
2308Detail       leaf [A. thaliana] PG plastoglobule 
2310Detail       leaf [A. thaliana] PG plastoglobule 
2311Detail       leaf [A. thaliana] PG plastoglobule 
2312Detail       leaf [A. thaliana] thylakoids thylakoid membrane 
2313Detail       leaf [A. thaliana] thylakoids thylakoid membrane 
2314Detail       leaf [A. thaliana] thylakoids thylakoid membrane 
2315Detail       leaf [A. thaliana] thylakoids thylakoid membrane 
2316Detail       leaf [A. thaliana] PG plastoglobule 
2317Detail       leaf [A. thaliana] PG plastoglobule 
2318Detail       leaf [A. thaliana] PG plastoglobule 
2319Detail       leaf [A. thaliana] PG plastoglobule 
2320Detail        [A. thaliana] Thylakoids plastoglobule 
2321Detail       leaf [A. thaliana]  
2324Detail       leaf [A. thaliana] THYLAKOIDS thylakoid membrane 
2325Detail       leaf [A. thaliana] thylakoids thylakoid membraneabc1k6
2400Detail       leaf-soluble [A. thaliana] GFP-nano-trap wt/DUF760-1GFP/ClpC1TRAPSTREP

* For details about the exprimental sources click here.

Published Proteomics Data

 15028209(Total chloroplast)
12938931(Total chloroplast envelope)
MitoDB(Mitochondrial proteome)
16207701(chloroplast stroma)
18538804(total leaf)
18633119(stroma)
18431481(chloroplast)
19452453(14-3-3-interacting proteins)
19546170(mature pollen grains)
19525416(leaf (wt and clpr4-1 mutant))
17216043(leaf)
19334764(plasma membrane (cell culture))
20423899(chloroplast)
19888209(leaves)
20166762(whole leaf)
19114538(guard cells Arabidopsis leaf)
19423572(leaf (wt and clpr2-1))
19423572(stroma chloroplast (wt and clpr2-1))
20061580(chloroplast envelope (inner+outer))
19995723(chloroplast reference proteome)
21515685(GreenCut2)

Comparative Proteomics Data
Expr*SourceTech.SpotPepSeqChargeState(z)AreaRatioAmbiguityTissueSample from
180_181clpr2-1 cICAT - exp1 / wt cICAT - exp1cICAT1LHNNTSPDDVVICQALMDYIK + ICAT_l / LHNNTSPDDVVICQALMDYIK + ICAT_h31.39 leaf [A. thaliana] chloroplast stroma
180_181clpr2-1 cICAT - exp1 / wt cICAT - exp1cICAT1YLEILQPSAEYLGSCLGVDQSAVSIFTEEIIR + ICAT_l / YLEILQPSAEYLGSCLGVDQSAVSIFTEEIIR + ICAT_h31.31 leaf [A. thaliana] chloroplast stroma

©Klaas J. van Wijk Lab, Cornell University   Web Accessibility Help